PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019174m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 672aa    MW: 74342.6 Da    PI: 6.3025
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019174mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3727.7e-23128228198
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++ +k+a+e+       + ++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +
  Ciclev10019174m 128 FCKILTASDTSTHGGFSVLRKHATEClppldmTLATP-TQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGE 218
                      99**************************999744433.459************************************************..449 PP

                      EE..EEEEE- CS
               B3  89 efelvvkvfr 98 
                      ++el+v+v+r
  Ciclev10019174m 219 NGELRVGVRR 228
                      999*****98 PP

2Auxin_resp102.74.5e-34254333183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aaha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d++  +Wp+SkWrsLk
  Ciclev10019174m 254 AAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERRFTGTIVGVGDFSE-QWPGSKWRSLK 333
                      79****************6..9**********************************************888.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-40117257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-39121243IPR015300DNA-binding pseudobarrel domain
CDDcd100178.18E-20126228No hitNo description
PROSITE profilePS5086311.899128230IPR003340B3 DNA binding domain
PfamPF023626.7E-21128228IPR003340B3 DNA binding domain
SMARTSM010191.7E-21128230IPR003340B3 DNA binding domain
PfamPF065073.9E-32254333IPR010525Auxin response factor
PfamPF023093.4E-10543644IPR033389AUX/IAA domain
SuperFamilySSF542772.42E-12550632No hitNo description
PROSITE profilePS5174525.037556637IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MAYVEPNFGC SLSSQGGPGS GDLYRELWKA CAGPLVEVPR NGERVYYFPQ GHIEQLEAST  60
NQELTHQEPL FDLPSKILCR VVHIELLAEQ ETDEVYAQIT LHPETDQTEP RSPDQCLPEP  120
PKQTVHSFCK ILTASDTSTH GGFSVLRKHA TECLPPLDMT LATPTQELAA KDLHGYEWRF  180
KHIFRGQPRR HLLTTGWSTF VTSKRLVAGD AFVFLRGENG ELRVGVRRLA HQQSSMPSSV  240
ISSQSMHLGV LATAAHAVKT STLFIVYYKP RTSQFIIGLN KYLEAVHHCF SVGMRFKMRF  300
EGEDSPERRF TGTIVGVGDF SEQWPGSKWR SLKIQWDEPA TVQRPERVSP WEIEPFVASA  360
PLNLAQPAVK SKRPRSIDIP ASEITTNSAA SAFWYQGSTQ SHDITQVVGA TEGQSSESQV  420
VRPMRQKEID STIINNSNDC SSRLAPEGIW PSSPHLNVSL NLFPDSTDDH RIVAAQSVLS  480
GYASSGRPGN TVIHEEVERG KKSEASLGCC GVKGSARAAS DFDASQNQDL KEVKRGMADV  540
SRKETQNKQG SAASTRTRTK VQMQGIAVGR AVDLTALKGY DDLFDELEKM FEIQGQLRPR  600
DKWAVVFTDD EGDMMLAGDD QWPEFCKMVK KIFIYSTEEV KNMATSSKPI ASSVEGEGTA  660
ISLDSELKSE T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-175143567355Auxin response factor 1
4ldw_A1e-175143567355Auxin response factor 1
4ldv_A1e-175143567355Auxin response factor 1
4ldx_B1e-175143567355Auxin response factor 1
4ldx_A1e-175143567355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006491295.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A067HEU10.0A0A067HEU1_CITSI; Auxin response factor
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9